SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009384 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009384
Domain Number 1 Region: 42-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000068
Family HkH motif-containing C2H2 finger 0.039
Further Details:      
 
Domain Number 2 Region: 244-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000042
Family HkH motif-containing C2H2 finger 0.096
Further Details:      
 
Domain Number 3 Region: 191-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000504
Family HkH motif-containing C2H2 finger 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009384   Gene: ENSORLG00000007485   Transcript: ENSORLT00000009385
Sequence length 404
Comment pep:novel chromosome:MEDAKA1:7:12173177:12229791:1 gene:ENSORLG00000007485 transcript:ENSORLT00000009385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILGSINRAGAAVPTFLRTPTVIQPLLDMKPFLQFPMETPPPPHSMNLFHNFNTMDPVQK
AVINHTFGVPLVKTKRPVISCNVCQIRFNSESQAEAHYKGNRHARRVKGIETSKSRPQER
DKLHSLPPTSSPSPPGAPGNEVQSLSHINGSLLTSGALSSLPASPTPPMDSPVPSPGSGP
VVAAAAGTPTSSSPSNPETEDDKAKKLLYCSLCKVAVNSLSQLEAHNKGTKHKTILEARS
GLGPIKAYPRLGPKPNGEQGGGPVDPNTQERTFHCEICNVRVNSELQLKQHISSRRHRDG
MAGKPNPLLSRHKKHRGADLTSSLNFSKDLTKALGAGLLPNPLAVAAAMAAAASSNQLAM
RAAAPGHHPHPHHLLQGHHLSHAILRPAPGPIRTTHGPILFSPY
Download sequence
Identical sequences H2LTG5
ENSORLP00000009384 ENSORLP00000009384 8090.ENSORLP00000009384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]