SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009389 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009389
Domain Number 1 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000119
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 2 Region: 219-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000744
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 3 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000911
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 163-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000159
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000009389
Domain Number - Region: 14-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0185
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009389   Gene: ENSORLG00000007490   Transcript: ENSORLT00000009390
Sequence length 486
Comment pep:novel chromosome:MEDAKA1:14:15419154:15423480:-1 gene:ENSORLG00000007490 transcript:ENSORLT00000009390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVKRVKKKTLKLDCEWGSCQETFSRIEKFCEHAEAHLTAPSIDEDADACEEERNCLWR
DCGFCTVEGSGELRRHVFFHCYHTKLKQMGQQVLDAQPEVGNCSIAQHNRNIIPELPDNF
VCLWEECDQPPYENPEWFYRHVEMHGLAIDIPQGECEFPIRCRWKDCEATAKGRPKLREH
LRSHTQEKLVACPGCGGMYANNTKFFDHIIRQSAMEGQRFQCSHCFKRFATERLLRDHMR
THVSHYKCPLCDMTCPTPSALRSHIKFRHSNEKPYSCDYCEYSCKNLIDLRKHLDTHSSD
PAFRCDFPGCSFASRNLGTMKIHYKKEHEGTFTARYKCHVCGQCFTRGNSLTVHLHKKHQ
FKWPSGHPRFRYKEHEDGFMRLQLIRYESVELTEQLMRERQKRQTEEDTGSEHAEDQELE
EEPMAASEVQVELRGVLLEEKRNEELNVGAEEGVQEEGVLYVLSEGESSVLLELQDTTQQ
QQIEFM
Download sequence
Identical sequences H2LTH0
ENSORLP00000009389 8090.ENSORLP00000009389 ENSORLP00000009389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]