SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009433 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009433
Domain Number 1 Region: 259-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 2 Region: 292-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000779
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009433   Gene: ENSORLG00000007526   Transcript: ENSORLT00000009434
Sequence length 351
Comment pep:novel chromosome:MEDAKA1:7:12315360:12317000:1 gene:ENSORLG00000007526 transcript:ENSORLT00000009434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTIQRTDNFLHTFLQDRTPSSSPEGAPNALSFLATTCSQAWQVGGTMGSEGSQFPYE
GTVSSTSGMFQLWSNDMAPSSALSTHQMTFSMPKVQFPGHMQSGLNELPLTPPAEPASTY
SFELSPVKMLSSQPQASSPYYPQHNSVGQNFPSFLQNSSARHHLSGGHVEEGQQWWSLPQ
SNTTPSSHPFTLGRQLVLGHQPQIAALLQGTSKGLLSSTRRCRRCKCPNCQANGGGLEFG
KKRLHICHIPECGKVYKKTSHLKAHLRWHAGERPFICNWLFCGKSFTRSDELQRHLRTHT
GEKRFGCQQCGKRFMRSDHLSKHVKTHQTRKGRCGQPAQSTEPLLTNIKRE
Download sequence
Identical sequences H2LTL4
8090.ENSORLP00000009433 ENSORLP00000009433 ENSORLP00000009433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]