SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009456 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009456
Domain Number 1 Region: 138-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-16
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 171-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000676
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009456   Gene: ENSORLG00000007542   Transcript: ENSORLT00000009457
Sequence length 247
Comment pep:novel chromosome:MEDAKA1:6:11937694:11947977:1 gene:ENSORLG00000007542 transcript:ENSORLT00000009457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLKDKMDHFAAECLVSMSSRAIVHPPKGNREIKPEIPSSSRIGEDMKEPLVKDNSSLFVV
ARILADFNQQTPNGEEAKIKDESTPNLREDGNSATPTTFPDPLPKQRGKRSRGRTEQESP
QKKHKCHYSGCEKVYGKSSHLKAHLRTHTGERPFPCTWPNCSKKFARSDELARHYRTHTG
EKKFGCPLCDKRFMRSDHLMKHARRHSDFQPGMLKRPHGGSTPRPSSLSDYSRSDASSPT
LSPANSP
Download sequence
Identical sequences H2LTN7
ENSORLP00000009456 8090.ENSORLP00000009456 ENSORLP00000009456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]