SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009532 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009532
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000218
Family HkH motif-containing C2H2 finger 0.0042
Further Details:      
 
Domain Number 2 Region: 130-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000238
Family HkH motif-containing C2H2 finger 0.014
Further Details:      
 
Domain Number 3 Region: 10-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000187
Family HkH motif-containing C2H2 finger 0.0061
Further Details:      
 
Domain Number 4 Region: 200-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000025
Family HkH motif-containing C2H2 finger 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009532   Gene: ENSORLG00000007607   Transcript: ENSORLT00000009533
Sequence length 238
Comment pep:novel chromosome:MEDAKA1:15:21897100:21924061:-1 gene:ENSORLG00000007607 transcript:ENSORLT00000009533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAGVVDGGLFTESYCNICNAQLISESQRTAHYESKKHANKVRLFYMLHPEDGGPPSKR
LRPDNPDCAETEVDRNKCCTLCNMFFTSAIVAQSHYQGKTHAKRVRLVLGEPPNLTTATA
NPTNTDPAACPPAPPALPWPTAVGSGNGGREAGKYCCLCGAWFNNPLMAQQHYEGKKHRR
NAARARLLEQLAGSLDATESTGLRSSYSCSICSVVLNSIEQYHAHLQGSKHQNNIKKK
Download sequence
Identical sequences H2LTW1
ENSORLP00000009532 ENSORLP00000009532 8090.ENSORLP00000009532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]