SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009566 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009566
Domain Number 1 Region: 109-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-18
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 161-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000354
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 369-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000229
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009566   Gene: ENSORLG00000007632   Transcript: ENSORLT00000009567
Sequence length 426
Comment pep:known chromosome:MEDAKA1:7:12480749:12485776:1 gene:ENSORLG00000007632 transcript:ENSORLT00000009567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAEQDLYGSLQGPSTKSPSSRQSSPRRSLSEKANSIKVEMCSDEESSGAPQPEIKEAVR
VDGRKDDRRDPTEEGASEFAGVRRNRASIYNDLASPNSTSPGPIRLPNGKLQCEVCGMIC
IGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCPICNYACRRRD
ALAGHLRTHAVSSPTVGKPFKCSYCSRSYKQQSTLEEHLERCHSYLKTLDPQTAVNNQTS
QESVNMETVSKPVLQPSSEKIHFVDRLSVSITKRKRSTPQKFLAMSLALPGRETGDDQPS
AHSHTTSPNGCPDSTDTESTAEEHSTRATAPTSTSNHHHLHYQAPILPHCHPTSRDSLQV
LDKGGRSVRSFYCRHCRILFLDHVMFTIHMGCHGFRQPFECNICGHSSQDRYEFSSHISR
GEHQVG
Download sequence
Identical sequences H2LTZ3
8090.ENSORLP00000009566 ENSORLP00000009566 ENSORLP00000009566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]