SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009727 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009727
Domain Number 1 Region: 37-140
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 150-270
Classification Level Classification E-value
Superfamily POZ domain 0.00000000785
Family BTB/POZ domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009727   Gene: ENSORLG00000007768   Transcript: ENSORLT00000009728
Sequence length 597
Comment pep:novel chromosome:MEDAKA1:8:10510568:10513124:-1 gene:ENSORLG00000007768 transcript:ENSORLT00000009728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTQNLRFLWPFLLLHVFAGAFRFDTLKQNGEPQEGDLRLSDGESPAEGRVEVFHNGKW
GTVCDDGWDMKEAQVVCRQLDFPGAKSVITGKSYKQASGPIWLDDITCNGNENSLVSCSF
KGWGLTDCTHKEDVGVVCETGSNSLTNNTTTHSMDHSISLSNDLGQLFDTATNCDLNILL
QSTTGNRQEDDVPEMVGTTICAHKAILSLFPRFKVFPETTNITVEVRKPCQPYFSSLIRY
LYTRKIDVTFSSALCLHQMASSFGVKQLMEDVGRLFTQIFPDDSSFYTHVSIYQYAVETT
DTILEENLIQYLAWNYQNLTDSPAWNDLPVKLLQALLARSDLVVPDESFVLETLESWITD
RALLNSSDTVLALLSGIRFPMISAEKLLELESSSPLYQIYKNVYREFTLKAYQFNVLLFS
NLTTNPNIKKDIGNYSPRIYISEPWSKVLREPRKASPNQYPYQYQYQNQFGGSYNRYDRY
DIRSGFTTPLHNSLLFRDRKTSWEANVFTRQSDCSNRGVRCESVPAAMLSEQSYSSRPSS
IRFSNRLLLMCQNTYIFQVQSFKDNMAYIFKNDTQASPYPCVDNKYTYVFVVRPEYV
Download sequence
Identical sequences H2LUF0
ENSORLP00000009727 8090.ENSORLP00000009727 ENSORLP00000009727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]