SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009865 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009865
Domain Number 1 Region: 2614-2684
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 2 Region: 2232-2296
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-18
Family Homeodomain 0.0056
Further Details:      
 
Domain Number 3 Region: 2904-2985
Classification Level Classification E-value
Superfamily Homeodomain-like 1.11e-17
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 4 Region: 2135-2206
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-16
Family Homeodomain 0.012
Further Details:      
 
Domain Number 5 Region: 2999-3044
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000927
Family HkH motif-containing C2H2 finger 0.00081
Further Details:      
 
Domain Number 6 Region: 1565-1638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000065
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number 7 Region: 726-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000084
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 1422-1469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000223
Family Classic zinc finger, C2H2 0.086
Further Details:      
 
Domain Number 9 Region: 1988-2010,2315-2340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000707
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000009865
Domain Number - Region: 2515-2538,2692-2717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000147
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 809-847
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000315
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 3482-3520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0026
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 
Domain Number - Region: 1381-1408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00319
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1098-1128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00578
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 651-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0177
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009865   Gene: ENSORLG00000007874   Transcript: ENSORLT00000009866
Sequence length 3693
Comment pep:novel chromosome:MEDAKA1:3:19183333:19258428:-1 gene:ENSORLG00000007874 transcript:ENSORLT00000009866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSCESPVASGADNGLGSSQQQPPQPWNDHSNSQVNCTNQAPSLDALNLSSPYPSQPQNS
IAPHDGVREQQQPKQTPPQEEESEDLDEMEIDSCFPSLQPFPVRHQPTQQQGPPESGSED
GEEEEEEESSDVENLAGEIVYQPDGSAYIVESLSQLIQSSGGMVPGLLSTNSLTSGGKQG
EPTGNSSSVYPQIINTFHIASSFGKWFGNSDQGFPNTSTMAGLSPVLHSFRVFDVRHKSN
NEYLNSDGSAKKSCVSKDVPNNVDFSKFDGLALYGKGKPILMCFLCKLSFGYARSFATHA
VHDHRMTLCEEERRLLGDKHASAIIQGIGKDKEPLISFLEPKNKSTPLPPTLLPMNSGQS
FYGTFSGVHLDLGGSSGGSETLVNKDSESSLQLQHQQQGTLGSVLSLGALSIPKASTLTS
SPGPAKDSSALPKQGGTIEEPLRKELVCQREGENNKGHENKVQLSNQMVGLEEDEELVLG
EEDDDIEAESTGMACGGNGSSGGSEAGEAAVSNQSISKSPLLMPSSTLQPSACTAAVSST
LNSKAPASISSSVNFNCQGPVAPLAMAAEAVRRSEDDTACTSSSPLSSNAADESANRDSA
TAPEPNDCPAEGDEDNGTLLHHHHRGSCDSAGMGECSQNHGPSGSGGSGVECPKCDTVLG
SSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPDSGGSCVYCSSGQSH
PRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNMQTLQNGGSIGSTQEQV
FGHAPGGVVAVPSVTQSSTHMPVPCGAPSPTKPKSKPTWRCEVCDYETNVARNLRIHMTS
EKHMHNMMLLQQNVTQMQHGRLGLGAMPSPSEAELYQYYLTQNMSLPPGLKIDTAGPEAQ
FLMGSFHLDPSMAALAPALVGGEIPMDVRLGGGQLVSEELMTLGESLSQTTDPTLKLFQC
AVCNRFTTDNLDVLGMHMGAERTLPEEEWRAVVGDSHQCKLCHYTTQLKANFQLHCKTDK
HVQKYQLVAHIKEGGKGNEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRMHTVNSRHEAS
LKLYKHLQQHENAVEGDACYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKG
LPEEEEDLSSIFTIRKCPSSDTGELSEDVEAASETTTDQEDQTKDRESGALSSHTERHLS
DSPNSSKRPSSRSGTSESVLSSKRPRTAEKGTAEQIIQCKSFLRYSKINLLCLNLNGIFQ
YPYNSFIYLILNQENYRNTVHYGNNQNNSFFPCPTVIHSSKLEKVTATEALPATMFIPVA
SPDRESRSTPQATANSNIEDLKKQTDAADADLEKGVSLPTDITEAQKTALEDQQLEDATG
FLCWKKGCNQVFKSSNSLQTHFNEVHNKRSQLPVSDRHVYKYRCNQCSLAFKTIEKLQLH
SQYHVIRAATMCCLCQRSFRTLQALKKHLETSHLELSEADIQQLYGGLLMNGDIMVLGDP
TMGEEHGGLGEDEKEADDSDQEDKQSPTGSDTGSLQEDSGSEPKRALPFRKGPNFTMEKF
LDPSRPFKCTVCKESFTQKNILLVHYNSVSHLHKVKRALQESTTGQPEPTSSPDNKPFKC
STCNVAYSQSSTLEIHMRSVLHQTKARAAKLEAAGGISSSASSTGPSGGGSNISTSTSSP
TPASNSATSSTSHSSSAPQTAQSIHMNQPHSIENIGNSSSTCRSSPSENHEAKKSKFSEI
LSARELAQAQAQAQAQLQQELQQQAALLQSQLFNPALLQHFPMPTDALLPLQQQQLLFPF
YIPGAEFQLNPEININNSALGLTGSSTSSLLEDLKNSAQQAQQSCQAQVQAQMGLLHQSA
SLLQQADKKHKQLIEKDREIQKDKDTTEKHDDCINKDTTEAKPKEKKDIQHISININQDT
GLIPPRIASDARGNATKALLENFGFELVIQYNENKQKAQKKSSGPTGSSGPGGITRVVDP
IEGLEKLECETCGKLFSNILILKSHQEHIHQAFFPFQSLERFAKEYRDYYDKLYPLRPST
PEAAPPQRVPTPNIPVSVASLTPPTVPTSQPQVPMTQLPMPMDLPLFSPLMMQPMPLQSL
SSQLPPQLQSVEPSLASDLAQLYGQQLTPAMLHQQNKRPRTRITDDQLRVLRQYFDINNS
PNEEQIKEMADKSGLPQKVIKHWFRNTLFKERQRNKDSPYNFNNPPTTTLEDTKIDSKPP
SPEPQKQEMYGSKRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLSLPTRVIVVW
FQNARQKARKNYENQGDGGKEGERRELSNDRYIRTSNLNYQCKKCSLVFQRIFDLIKHQK
KLCYKDEDEDGQYDSQNEDSFDLSQDCYTPSGSSCHTPMPSSSSLCPLPPSTSSFSHLTS
TEKEEASPATTSNFYDEKPKQLPEICADPRENQMSIKQEIIHQPQSEAQLHRSQREDKIQ
NVSKSVKHSSQSFSQQQQQSGPSAPQTSQASSQGAHISVTQHLTAAAQLAQAMIPYQCEQ
CKIGFPSFEHWQEHQQLHFLSVQNQFIHPQFLDRPIDMSFMLFDPSNPLLASQLLPGAMP
QISSSSATSPSTPTSTMNSLKRKLEEKASTSPGENDSTNSGEEPQRDKRLRTTITPEQLE
ILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKGQFRAVGPAQAHRRCP
FCRALFKAKTALEAHIRSRHWHEAKRAGYNLTLAGMLPEQESIQMKMDALETSNYSQLVP
TTNSDGQSSSMSPVNKNVDLSPRHLLSPSSIKVEGMEDFESAAMSSVNLSFDQSKLDNDD
CSSVNTAITDTTTGDEANADNDSADPKHSQNSGDYLSKSTGTAPSLENDDQMSSGLVSPA
TSYYAKDYDNENMIDHSETSSLADPCSPSPGASGTRSIDSGDRPGQKRFRTQMTNLQLKV
LKSCFNDYRTPTMLECEVLGNEIGLPKRVVQVWFQNARAKEKKAKLNMAKHFGINQTSYE
GPKTECSLCGVKYSARLSVRDHIFSQQHISKVKDTIGSQIDKEKEYFDPATVRQLMAQQE
MDRIKKANEVLGLAQQQAMQQQGMFDNPAMQALNLQSAYPNLQGIPPVLLPGVGSPSLSS
FNSSNSALTSPKPPNLLNLPGASVPSPSLPTSGLPNKPPPSSSLAASSPAQTNSSASHSS
PTPTSNSTSSTTPSGLRSEPPREREPERMVEKEKGKEKPEKPSTPSSAGSTPAPSTSAAS
AKKEKPDTAVPATSMPTPGMEYVVDPAQLQALQAALASDPTAILTNQFLPYFMPGFSPYY
TPQIPGALQGGYLQPMYGMESLFPYNPALSQALMGLSPGSLLQHYQQYQQSLQEALQQQQ
RQLQQIQQPKTGQTLVPPQTSGDRKDSAKDSIKKEEQKGNPTSSTTSHSKLPSDKSEMDG
KALDYHLDQYIVPKVQYKLACRKCQAVFTKEEAAVTHVKSNCFFGQSVANLQEMLLRVPS
GVGVGAGSLYDCLACDTTLDGEKALSQHLESALHKHRTIKRSVRNAKEHATSLLPHSSAC
FPNPNTTSTSQSATHPISSPPSLPTSATMPSSAVPSSLCSSTATLSTTAAGKSWSQASFS
RALAGKTNASPLSFSFPPVSSPSTVTSSSLSTSGVQTSIPTDNFTDESDSDCSQKSADRL
GMTAEEPQQPGFVKDSNSCSSNLASVGTDSIRL
Download sequence
Identical sequences H2LUT7
ENSORLP00000009865 ENSORLP00000009865 8090.ENSORLP00000009865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]