SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009892 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009892
Domain Number 1 Region: 14-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-39
Family DBL homology domain (DH-domain) 0.00097
Further Details:      
 
Domain Number 2 Region: 378-560
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-27
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 212-329
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-24
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009892   Gene: ENSORLG00000007888   Transcript: ENSORLT00000009893
Sequence length 562
Comment pep:novel chromosome:MEDAKA1:5:14605990:14624717:-1 gene:ENSORLG00000007888 transcript:ENSORLT00000009893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLPSVQQIDGRSRAFYIAKELVDSERLHVSALKHIQEDFRSAVAEAVNEEGEPVLEEQK
LGEILTVLPEVYRLHCSILADMEERISQWEESQKMVEAILSRQDDFGVFDTYICQYDRSM
SLLKQSCRNNPAFANIVKKFEMRGEEESEVPLNHQLLHVVVRVLQYRMLLTDYLNNLSPD
SKEYTDTQAALVIVSEVADQANDNLKQGENLLRLVHIEYSVKGKRDLLKPGRIFVKEGTL
MKVSRKSRQPRHLFLMNDMMLYTYPQQDGKYRLKNTLPLSGMKVSKPVLENVLNCLRIEV
SDITITLSASSVGEREDWFHTLSRAIADHAAGLCTFGGPCSEAREKLWMALGKTAPVLVP
VSQVMMCMNCTTDFSLTLRRHHCNACGKVVCRACSRNRYPLKYLKDRMAKVCNLCFAELE
KKADKSTLTFTLAGGSVPAACDNSSLRSHRAIRQVSLGVEGSTMSGSLQRRKKSKRKWKR
LWFLLKDKVLYTFTAREDKVASESLPLQGFTVKLTEAPEEEDSSSSSVFHLYHKKTLYYT
FKADDQHTARRWVNAMEEATVL
Download sequence
Identical sequences H2LUW4
ENSORLP00000009892 8090.ENSORLP00000009892 ENSORLP00000009892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]