SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009926 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009926
Domain Number 1 Region: 772-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000701
Family HkH motif-containing C2H2 finger 0.05
Further Details:      
 
Domain Number 2 Region: 972-1010,1069-1346
Classification Level Classification E-value
Superfamily ARM repeat 0.0000102
Family Armadillo repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009926   Gene: ENSORLG00000007912   Transcript: ENSORLT00000009927
Sequence length 1388
Comment pep:novel chromosome:MEDAKA1:6:12544777:12595361:-1 gene:ENSORLG00000007912 transcript:ENSORLT00000009927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQASFQRSNSHDKVRRIVAEEGRAARNLIAWSVPLESKEEEVKSKGNSSGSSRFQRINSG
QHKNKKQNAGVDIKGTAGALLDKGPKKSPTKVKQPRKVNLRARYWAFLFENLRRAVDEIY
VTCESDQSVLECKEVLMMLDNYVRDFKALIDWIQLQEKLEKTDAQNRPTSLAWEVRKMSP
GRHVMQSPTSDRVVPSTGARRALNFGGPPSTLAAARLSHTGPSWADRVKCTKFDNSNSQP
NVFPAEKPGKKDAEGWETVHRGRTAKPRSAAIVAKVSPVVAQVNPKQDSAKCNRSLVVPQ
EEQHPRPELPSECETFNSLCRNANMYFCCSVSLNSSSMDVYSMLELKKNSXNFQESTVHT
SLTPSPASEGIPSAPTFPPTDTAVLLAVPSVAITSRTDPPQEEGIRQAETPMAVVKLESV
LDPTELSTVSAERWRSSRREGLRRRESPRVRHRLNKXKNNNDYFHTSIACGSYGANMEWS
DMLADFDAREPWRQSTSWGDIVEEEPARPPGHGIHMHEKLSSPSRKRTIAESKKKHEEKQ
LKAQQLRDKLREEKTFKLQKLMEREKDVRKWKEELLEQRRKMMEEKLLHAEFKRELQLQA
IVKKAQEEEAKVNEIAFINTLEAQNKRHDALAKLSEYELRLNELQEERQRRQEEKQARDE
AVQERKRVLEAERQARVEELLIRRKEQEARIELQRQEKEKAREDAARERARDREERLAAL
SAAQQEAMEELQKKIQMKHDESSRRHMEQMEQRKEKAAEFSSGRHANTDYAPKMTPYERK
KQCSLCGVVITSEVHLFSHTKGKRHQQAVRDSSSIQGRELSDEEVEHLSLKKYIVDILTD
SSVSSEGVKDGEERQKARKKAKKLRARMNSRAKEYETSMDAKAQVPDSPYKAKLQRLVKD
LLKQLQGQDSGQWANNKVSGLDRTLGEVSRIFEKQNTADQVVFQVSGGLSALEQILQVIT
AASTPIAVPRIPPKSLCAAVNAYYLACSCCPTNCSYVLFTNKIVLLMDLLLHQLTLFVPD
EDNSIFGRSVNKLVFEGLTTGLLQTIAAILESLWPNNSDVGKSGNTAISSSDAKVKTSAT
ESFNTRAQDLISYVVNMGLIDKLYGCFLSIQSPVDEHPKMSAFLQQASAVLHSICRLCFV
VTVRPSSIFDNKRQDPTGLTALLQSTDLVGVVHTLYCILLHTFSPESGAQSQEPYSAGVI
QVALQGIRFLNIFALLDLSAFQSVLGAEGLSLAFRHIISSLLWYCTQHSSEELLHEAIIC
VGYFTVNHPDNQVIVQSGRQPSVLQKLCQLPFQYFSHPRLIRVLFPSLISACYNNSHNKA
ILQQEMSCVLLSTFIQDCVANEKDSDTKTTNTVCSDIHKMLDFCELSNRFPADQWDSALQ
FFLKKQEE
Download sequence
Identical sequences H2LUZ8
ENSORLP00000009926 ENSORLP00000009926 8090.ENSORLP00000009926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]