SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010024 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010024
Domain Number 1 Region: 13-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000136
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010024   Gene: ENSORLG00000007989   Transcript: ENSORLT00000010025
Sequence length 266
Comment pep:novel chromosome:MEDAKA1:3:19857883:19860026:1 gene:ENSORLG00000007989 transcript:ENSORLT00000010025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSLDFSSPDRLISHVYQHTSMMSNSKSYVCPVCGRALSSPGSLGRHLLIHSEDRLSNCA
VCGARFTDTTNLNRFCSFTIKNLKSTEKMHKRSVSGLPPIPDILSPMPVCPAGVLLVCNN
CMAYQQLMESQSPLRKWALRRKNEPLEARLQRLERERTAKKNKRACETEEEREIRRLRDR
EAKRMQRMQETEEQRARRLQRDREAMRLKRANETPEKRQARLIREREAKRIKRRLEKIDP
ALRTQIEHDPAAMAALTADMNLFQFP
Download sequence
Identical sequences H2LV94
8090.ENSORLP00000010024 ENSORLP00000010024 ENSORLP00000010024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]