SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010060 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010060
Domain Number 1 Region: 963-1013
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000586
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 2 Region: 731-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000358
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number 3 Region: 788-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000439
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010060
Domain Number - Region: 1105-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000365
Family HkH motif-containing C2H2 finger 0.066
Further Details:      
 
Domain Number - Region: 881-908
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00681
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010060   Gene: ENSORLG00000008019   Transcript: ENSORLT00000010061
Sequence length 1167
Comment pep:known chromosome:MEDAKA1:6:12647212:12653357:-1 gene:ENSORLG00000008019 transcript:ENSORLT00000010061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMKTPDFDDLLAAFDIPDATGLDAKEQIQISHEETENQLKHDEMCLDKSLLDNPGVLP
SDVPVVSVIVKNTSRQESIEEHRDRHHSGTTLQNGFTGQETYVDPSEERDGCFSKLFVST
LNGESSPEIPKDVPNQYSAGQTPIFSSSHSHFNSVSSPEPENTLTSKDETLSIQDGNYPE
APVLDDSSLANNQRKFDFSLFDNCSQDVQESRVEVGRSNPPADKSINSETNKGSEEGNTF
LHLHRNQNFTETNCNANYTVDATDSHLSAKSDTSKVSSCLEALNALNARKDPKESIYSTA
SPGIQNDLLKASPKVPISPKSPRSPLDAVKRVIKPSDSPVSICSDGSDKASLALASGLSP
AIPKVRIKTVKTTSGQIKRTVTSVLPESETDDIYSAYESSPSQSVISEDSYSVSPHPFQM
SEHAVGKKSKGSPASITSLNVLDRKSEQNSRKSLALGNANVGKRSSTHRGQKPKRTSSTA
GQKANTTFLPKAVHLASLNLVPHSVAASVAARSASHLQSNSTLSSSVCSGVPLVHQVTAA
NPFPCANVPNTAAGTLHRLLNCANPVPTYVPNLTPPPESNINLPPNGYCCLECGDSFGLE
KSLLGHYSRRSVHIEVGCTHCAKTMVFFNKCALLAHAREHKSSGVVMQCTQLHLKPLSEE
HMFAPLSPEPVSLASCTSSLSSSRIEPVLPLYPDNIIRHRHHCVECNKQLHDYKALAGHY
QKTSEDVEGLICLVCSMLLPNKCSLRAHQRLHAHKSPYCCPECGGLSRSADIQKHVKENC
LHYARKAWYKCLHCDMVFRTLQGQETHIEEKHCDVFYKCNVCPVAFKTSDACEVHLKNKH
SASKLALDRLVLKCSCEALFKKKHLLFQHFHQNANKRLICVFKCPECNSVFPQKRLLMLH
FKSVHAGNMTADVHKEAKEKDKTSLHPDVHSAERPQSTDVHKFTGNGRKKSKDIKPQMKP
SGWTCGECLQWFSDRESYVSHVKTNHGKSVKKYPCRHCEQSFNSAITLRRHIRSDHDGKR
RIYSCWYCTDTKTIFTTSVMLKNHISLMHGIKNPDLSQMPKASLREYKEPLGKFPSVLPT
VDIQADQRDPTDQEAPSAKRPKTQHRCLKCGFTTDNRTDFQQHIPLHRTDESTPQCLHCG
LCFTSALSLNRHLFIVHKVKEEEEKAD
Download sequence
Identical sequences H2LVC9
ENSORLP00000010060 ENSORLP00000010060 8090.ENSORLP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]