SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010075 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010075
Domain Number 1 Region: 178-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.87e-17
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 153-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000911
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010075   Gene: ENSORLG00000008031   Transcript: ENSORLT00000010076
Sequence length 239
Comment pep:known chromosome:MEDAKA1:7:13017864:13022307:-1 gene:ENSORLG00000008031 transcript:ENSORLT00000010076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHHSNNSVRDHMKWAGLLGCEAVLSSMALMQANNIPGQKKVMSSLGQGHRSSPESHHSQ
HGHNHHGHQVHHGQGHHSHMGNQSGGSCPPLLIRKDGDYHSSRIIESKDMQTNQNMQPKK
KHKKSGSSNKVKEKVEHILPPIVMDDDNSLKVQKNFICDHCYGAFRSSYHLKRHILTHTG
EKPFACDACEMRFIQRYHLDRHKRVHSGEKPYQCDRCHQNFSRTDRLLRHRRLCTVGVS
Download sequence
Identical sequences H2LVE4
ENSORLP00000010075 8090.ENSORLP00000010075 ENSORLP00000010075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]