SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010172 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010172
Domain Number 1 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 344-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000171
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 425-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000223
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010172
Domain Number - Region: 313-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000165
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number - Region: 235-284
Classification Level Classification E-value
Superfamily SET domain 0.0085
Family Viral histone H3 Lysine 27 Methyltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010172   Gene: ENSORLG00000008105   Transcript: ENSORLT00000010173
Sequence length 535
Comment pep:novel chromosome:MEDAKA1:20:14813276:14816803:1 gene:ENSORLG00000008105 transcript:ENSORLT00000010173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSLSCFPVVLNEKSYQENMLKSSPVRGFYPAPHHYMDFLPRTHNLLDPLKSLGRLVSD
TRASLPLNMNNPFVLQSSHTASVLHELCVPGAPYLSHMMPMWSKAEELAAVVTEHAADPL
STDFSSKSGERSTTSSASTPPKEALLRALCADQSPQKKTATYDFSEEDLFMVLYGYSSSQ
ERSGGHAISGVVLPENSGKLVNTSEIKTYDDNTLMWEVFENGRLSHFVDGRGASGNWMSL
VKCARFPEEQNLVAVQVQGQIFYEVCKEIGPGQELLVWYGDCYTQFLGIPLTLKNPREDT
TSELPFTEDAGEGYKCDRCGKVFAYRYYRDKHLKYTRCVDQGDRKFPCHLCNRSFEKRDR
LRIHVLHVHEKHRPHKCSVCGKSFSQSSSLNKHMRVHSGERPYKCVYCNKAFTASSILRT
HIRQHSGERPFKCKHCGKAFASHAAHDSHVRRTHAREQPHLCELCGASFQKEQELRLHTK
SHKKRQIPDSISVSSSSVAGLPEDSLQEDHSEILKNKDLSIFPYTALNSEYRPWN
Download sequence
Identical sequences H2LVN9
8090.ENSORLP00000010172 ENSORLP00000010172 ENSORLP00000010172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]