SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010235 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010235
Domain Number 1 Region: 635-703,941-1278
Classification Level Classification E-value
Superfamily Ras GEF 8.37e-120
Family Ras GEF 0.0000167
Further Details:      
 
Domain Number 2 Region: 224-445
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-45
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-19
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 4 Region: 434-590
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000145
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010235   Gene: ENSORLG00000008149   Transcript: ENSORLT00000010236
Sequence length 1280
Comment pep:novel chromosome:MEDAKA1:6:12761054:12788713:-1 gene:ENSORLG00000008149 transcript:ENSORLT00000010236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFENESSS
RPSGLYLLEGCMCDRAPSPKPSLSAKECLEKQYYFTVSFTHENQKALELRSEDVKDCDEW
VAAISHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAG
LLKDNEKINASPAAAPNDDDDDSEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESM
RKRNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMF
LHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDK
LLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHIERNSLDYAKSKLEE
LSRIMHDEVSETENIRKNLAIERMIIEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGR
LGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVVSLIDCTLMEEPEGTDDESKS
DKSGQDMEHLDFKIIVEPKDSQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAF
EDNSKVTVPQMINSKHIRLSERTQQNRSDSSLYCDDVDIRFSKMMNSCKVLQIRYASVER
LLERLTDLRFLSIDFLNTFLHSYRVFTTADVVLDKLITIYKKPISAIPARWSFRSLELFF
ASNQNNKLLYGEPPGSPRASRKFSSPPPLAIAKNSSPNRRRKLSLNIPIITGGKALDLAA
LSCSSNGYASMYSTMSPFSKTTLDINKLYVSSPIASKIPDEGEDKKEKVEDTSVCKQGSL
ADLSVREESDNDQNQSDDGDAEASPTKSPTTPKNIKCKNSSEFSLFSYNNGMVMPSCREL
DNNRSALSAASAFAIATAGANEGTPTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNR
VLNVLRHWVSKHAQDFESNIELKTKVIVFLEEVMHDPELLTQERKAAANIIRTLTQEDHG
DNQITTEDVTQLVGGSKAEPFESHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKN
EKTPYIMRTTKHFNDISNLIATEILRCEDVVTRVSVIEKWVAVADICRCLHNYNAVLEIT
SSLNRSSVFRLKKTWLKVSKQTKALIDKLQKLVSSDGRFKNLREALKNCDPPCVPYLGMY
LTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDLQPKVAQYLLDKSS
ALDEESMYKASLRIEPKVPN
Download sequence
Identical sequences H2LVV0
ENSORLP00000010235 8090.ENSORLP00000010235 ENSORLP00000010235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]