SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010332 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010332
Domain Number 1 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 571-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000788
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000102
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 310-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000188
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010332   Gene: ENSORLG00000008229   Transcript: ENSORLT00000010333
Sequence length 687
Comment pep:known chromosome:MEDAKA1:6:12864037:12867151:-1 gene:ENSORLG00000008229 transcript:ENSORLT00000010333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEEESSHLVRTYPKMTEGHMDVSTQTEPVVVLSLAQAAVLGLISQNEIFGATIAPNGFYT
GESRECPPPPTEPVEYEYADQLIGANGDYLAEPAGELEPQNQCSEKNQCSEKRRPGPRGR
IKRPRTDEDPDAQLHTAPAQVKGERSESETPPSCVHMNSRHHSGKPEDQAVQQSSLKEER
VCGNCISCVRETSRPQSDGPPEQEQEEGAGREADKKEEKLVVEEEQEEEALNLKTTAESS
SPVENSFYDSNEVAYESSSDMQMPGEYEESGQAMLWSDPEGLARRMQIDRLDINVQIDES
YCVDVGEGLKRWKCRMCEKSYTSKYNLVTHILGHNGIKPHECLHCGKLFKQPSHLQTHLL
THQGTRPHKCTVCEKAFTQTSHLKRHMLQHTDVKPYSCRFCGRGFAYPSELRTHESKHEN
GQCHVCTHCGLEFPTYAHLKRHLTSHQGPTTYQCTECQKSFAYRSQLQNHLMKHQNVRPY
VCPECGMEFVQIHHLRQHALTHKVLTRTGGTKGMKEFKCDVCAREFTLSANLKRHMLIHA
SVRPFQCHVCFKTFVQKQTLKTHMIVHLPVKPFKCKVCGKSFNRMYNLLGHMHLHAGSKP
FKCPYCTSKFNLKGNLSRHMKVKHGIMDTTMDGHEPPQEAEGHEDYEEESLEFSERENRA
NNNNTPDVAKLSQMEYYGKSAGRFSTA
Download sequence
Identical sequences H2LW45
ENSORLP00000010332 8090.ENSORLP00000010332 ENSORLP00000010332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]