SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010377 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010377
Domain Number 1 Region: 47-103
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000118
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 111-162
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000209
Family Hairy Orange domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010377   Gene: ENSORLG00000008268   Transcript: ENSORLT00000010378
Sequence length 298
Comment pep:novel chromosome:MEDAKA1:16:13709888:13711461:-1 gene:ENSORLG00000008268 transcript:ENSORLT00000010378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNHNYSSSESDLDDNVEVEKDSGDENGPLDFHGSMSPSTTTQVQARKRRRGIIEKRRR
DRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAASGKGYFEAHALAKDY
RSLGFRECLAETARYLSVVEGRDTTDSLRVRLVSHLSNCASQREVHSGLEHLAWGSAYGT
APTHLPHHLLLQHPQGRTPAPKSNSTPPLIDGSGQSRLGVMPHTESTRVPPGGSLPFSLP
LATSKLSPPLVSSLSSLSSFPLAFGAFPLVSPGVASTVTPLSATSKPYRPWGMEIGAF
Download sequence
Identical sequences H2LW90
8090.ENSORLP00000010377 ENSORLP00000010377 ENSORLP00000010377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]