SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010392 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010392
Domain Number 1 Region: 30-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000345
Family C2HC finger 0.0021
Further Details:      
 
Domain Number 2 Region: 1-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000351
Family C2HC finger 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010392   Gene: ENSORLG00000008281   Transcript: ENSORLT00000010393
Sequence length 340
Comment pep:novel chromosome:MEDAKA1:5:15875751:15879011:1 gene:ENSORLG00000008281 transcript:ENSORLT00000010393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFFTCNACGESLKKAQVDKHVNICRGCQVLSCIDCGKDFWDDDYKNHTKCISEDQKYGG
KGFEAKANKGDVKQQQWLQRIHEALNKSSISPKLRDVLRQVSAYDNVPRKKAKFQNWMKN
SLKISNTSLHEEVWNIIAAAVDVPEDTQQHMEKEAEVQANTNGTQTPFGHEDVKKNKKMN
KRERKEARQQNNGKAPKLYDEQVTQEQKESQTGKRKKDGKRKHKEAEDEEQNCDENEISA
KKRIKVAAEANDAEMSNEAEDQAVPLGKFHWKETIMAVLRKTPDQELPIKRLKKKVLAAY
YSFTGERNFKTEEQLISTFNKKISKNPKFRVLKDQVKLVN
Download sequence
Identical sequences H2LWA5
XP_011473392.1.28442 ENSORLP00000010392 8090.ENSORLP00000010392 ENSORLP00000010392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]