SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010418 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010418
Domain Number 1 Region: 61-111
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000943
Family Viral proteases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010418   Gene: ENSORLG00000008304   Transcript: ENSORLT00000010419
Sequence length 402
Comment pep:novel chromosome:MEDAKA1:15:22515550:22519302:1 gene:ENSORLG00000008304 transcript:ENSORLT00000010419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLFLRLALSCRSAGKQFQYSNRSPQVRQWLVKRNQSTITVEAGTSSTPAATVPNAATNRI
VGRWLLGCSGLVVGAVVLGGVTRLTESGLSMVDWHLVREMKPPQTQEEWEAEFFKYKQFP
EFKILNHEMTLPEFKFIFYMEWGHRMWGRLVGLAYILPTIYFWRKGYFTRSVKGKVLGLC
GFVFFQGLLGWYMVKSGLEEKQDSYDVPRVSQYRLSAHLGSALLLYTASLWMGLTMLLPA
HKMVESKHLMQLRRFAKGTGGLVFLTALSGAFVAGLDAGLVYNSFPKMADKWIPDDLLAF
SPTLRNFFENPTTVQFDHRILGISSLAAITGLYLFSRRMVLPRRAKIAISLLATMAYTQV
ALGISTLLLYVPTPLAATHQSGSVALLTFAIWVLAELRRMPK
Download sequence
Identical sequences H2LWD0
ENSORLP00000010418 ENSORLP00000010418 8090.ENSORLP00000010418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]