SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010649 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010649
Domain Number 1 Region: 14-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.72e-89
Family Eukaryotic proteases 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010649   Gene: ENSORLG00000008481   Transcript: ENSORLT00000010650
Sequence length 257
Comment pep:known chromosome:MEDAKA1:18:21127944:21130812:1 gene:ENSORLG00000008481 transcript:ENSORLT00000010650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLLCTGCHSQRPACGRVLINSRIVGGQDASAGMWPWQAVLLQNGEFSCGGSLITDQWV
LTAAHCLSILDLNSTIVQLGAQNRSSDPNAVSRTLEDIVCHPEYDTQTLDNDICLIKLSA
PVEFNSYIQPVCLASQDSAFHDGTSSWVTGFGDNGFGSLPEILQEVNVPIVGPNRCRCYY
KDGNEITDNMLCAGLENGGKDSCQGDSGGPLVFESSSIWIQGGVVSFGAGCAQAYKPGIY
AKVSNYQDWISNTVTGT
Download sequence
Identical sequences H2LX01
ENSORLP00000010649 8090.ENSORLP00000010649 ENSORLP00000010649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]