SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010659 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010659
Domain Number 1 Region: 206-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000725
Family HkH motif-containing C2H2 finger 0.034
Further Details:      
 
Domain Number 2 Region: 106-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000164
Family HkH motif-containing C2H2 finger 0.0074
Further Details:      
 
Domain Number 3 Region: 41-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000556
Family HkH motif-containing C2H2 finger 0.0065
Further Details:      
 
Domain Number 4 Region: 254-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000165
Family C2HC finger 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010659   Gene: ENSORLG00000008490   Transcript: ENSORLT00000010660
Sequence length 550
Comment pep:novel chromosome:MEDAKA1:5:16163328:16168721:1 gene:ENSORLG00000008490 transcript:ENSORLT00000010660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSFECTPALSDTSNNTVSSPNAASVTDTDRVINTKHDSVHVEGEKSDEQLLQGLLTDT
YCHVCSSKLLFESHRLSHYEGKKHAQKVKVYLKTLRGEKNAEVKRTLQTNKNRFCELCNM
VFSSDVVAKSHYEGKTHAKTLRKHTLHPPVMLTSKEKLALTSSFLADQKSEELPSPNPAG
KIEQKAASDVGTELHLDPTAATGSTNSSLKDPDRYCSLCAASFNNPQMALQHYNGRKHQR
NVARQELLKELGGDGQQELKQSQMTANSLMCQICGVPFDSVEMYQAHMQGNRHLTREKKI
SELFKSQPKVYNTFADELADYIQVQKARGITPKTSQGLAQGDAAKGDQEEEAQEESENWE
MAGTIPNPPHPPQSGTWHPVYPGSSCTLHNSGYNGPPPLLQCSDPSQFIIGPTESGQYRR
HLSSPSCSMSSSSSSSSYSSHTSDSDGGEHELKDRRTSTSTRKNGYMKKQAVESEDEGRR
KKQRISSDKKPKDKKQQSSVMEEEKDPHLQTTEHDKQAKLKYGKEKKKTKDKPDRRTEEE
KLWDDSILGC
Download sequence
Identical sequences H2LX11
ENSORLP00000010659 8090.ENSORLP00000010659 ENSORLP00000010659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]