SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010710 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010710
Domain Number 1 Region: 114-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000298
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010710
Domain Number - Region: 158-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00238
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number - Region: 35-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0462
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010710   Gene: ENSORLG00000008529   Transcript: ENSORLT00000010711
Sequence length 443
Comment pep:novel chromosome:MEDAKA1:3:20241741:20246891:1 gene:ENSORLG00000008529 transcript:ENSORLT00000010711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STTSTGGNKLIMLVADFYYGNFEGDLQKRDAQKTNNTFKCQSCLKVLKNNIRFMNHMKHH
LELEKQNSESWESHTTCHHCYRQYMTPFQLQCHIESAHSPIESSTNCKICELAFESEQVL
LEHMKANHKPGEMPYVCQVCNYRSSFFSDLEAHFRSVHENTKDLLCPFCLKVLRTSHIFM
QHYMKHQRKGIYRCGKCRLNFLTYKEKVDHRTHVHKTFRKPKALEGLPPGTKVTIRASLT
GKESTPVIPASPKRSVTPECRSSSPFTCEPSNSLTKFRLNDSAAQKAKMNQNKKRQEQNK
KQERRSFRHNLELKHLRFAFAFTTDLSEYSVSTLFFFSVKTGRYICIECNSVVDDFFVHF
PLLSNCGACKYRTSCKSSIENHMIKYHSTFRKRRVLKRNQKTNVSSLKLPLVCLTCDLLV
DSDLMTKHLVKQPNHVCKVIKEK
Download sequence
Identical sequences H2LX57
ENSORLP00000010710 ENSORLP00000010710 8090.ENSORLP00000010710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]