SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010759 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010759
Domain Number 1 Region: 209-465
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.83e-44
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 45-97
Classification Level Classification E-value
Superfamily GLA-domain 0.0000000000000365
Family GLA-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 87-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000519
Family EGF-type module 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010759
Domain Number - Region: 118-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000279
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010759   Gene: ENSORLG00000008569   Transcript: ENSORLT00000010760
Sequence length 467
Comment pep:novel chromosome:MEDAKA1:8:11788328:11792028:-1 gene:ENSORLG00000008569 transcript:ENSORLT00000010760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIHFTVPLFASLSGACVVGSCLSVFLEKQQATSLISRQKRAAEASTLEQACMEKVCTYDE
AKRFFQDTYRTDIFWSVYIDGDQCAEKPCKNGAMCLDSVGGYDCVCKSGFSGQNCQEDLT
LCVMEKDKGCSQFCKPGYVSYECSCAPGWKLSTTDRNTCMPAGMLFSYSSIKAGKMKTGL
QVHFSNGILVSAPDSQQFEEPKQSVCFYLSLNLKPTVPKPCGRLSSLSLWKSNQVSNIDG
VSCSSSDCPWQALLKNAESSGFCSGVILKENLVLTTAQCANKYSSFQVAVGKHQVSSESS
GKTLYVQVVHLHPRYVEGRPENNLAVIELRDRIIFGNQVIAACLPEKDFAESILMAGELP
AFTTGWKTSSQAVFQDQLTLKQLGYRPLNQCLTTYPSIMTNKMGCTTPAGGAECTMSSGS
PLLTMYRDVFFLTGILSQPEGAECSNGYVFQKVPRHLGWLQSIMGSR
Download sequence
Identical sequences H2LXA2
ENSORLP00000010759 ENSORLP00000010759 8090.ENSORLP00000010759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]