SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010806 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010806
Domain Number 1 Region: 119-325
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-56
Family DBL homology domain (DH-domain) 0.0000755
Further Details:      
 
Domain Number 2 Region: 341-464
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010806   Gene: ENSORLG00000008610   Transcript: ENSORLT00000010807
Sequence length 502
Comment pep:novel chromosome:MEDAKA1:7:14024632:14029830:1 gene:ENSORLG00000008610 transcript:ENSORLT00000010807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKRRKLVNFTFVTTMLTAELTKKCALCSDEEEEEEEEMSPDHMKDSEEPSNKRVKPVGK
SNSLTGVLPQMKTPALKRLSQSISRSISFRTDARPLPPALPRSRQKPSSFPRRRNSQCWS
DTVESHDLTAKEIKRQEVIYELTQGERQLIEDLSLVKKVYYDPMLKLDIMSESELGQIFG
TLESLIPLHTDLLSRLERLRGSEKTVGEVGPTLLNWFPCLEAYVTYCCNQVGAKALLDQK
KNEKRVEHFLRLCQESSFSRKLDLWNFLDLPRSRLVKYPLLLKEIQKCTPPEHPDEDYLP
DALELIQNIVAEVNKKTGEAECQFYRRGLHYLEDSQRLPEIQQSRFIYCHGELKNNKGQR
LHVFLFELALVLTKPGEEKDGGHVFNVYRQPLPNALINLEEIPDGEAGGGGTFRGAFTGG
NDKVKNCFRVSSRGRSKFNPYILQANDSFCKQQWITCLRQAIVQSRDRTAQTSQSQLSLH
PESGLCHIAELSLSSDTDMADH
Download sequence
Identical sequences H2LXE8
ENSORLP00000010806 ENSORLP00000010806 8090.ENSORLP00000010806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]