SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010871 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000010871
Domain Number - Region: 429-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00304
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010871   Gene: ENSORLG00000008664   Transcript: ENSORLT00000010872
Sequence length 561
Comment pep:novel chromosome:MEDAKA1:19:9262500:9264727:-1 gene:ENSORLG00000008664 transcript:ENSORLT00000010872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITSPTVSFLRNSTNPAWESGSTGEKGEGKIRQVFCFNSVSPADPSRQASRLPIKVLKML
TARSGHILHPEYLQPLPSTPISPIELDAKKSPLALLAQTCSQIGKPDPPSSSKLSSVTSN
GSSEKESKSGPLKMSDIGADDKSSFKPYSKSSEKKDSSSGGSLSGDKTSFRVPSATCQPF
TPRTGSPSSCTSVSPLPSDGKAGDKDEKKESDSNKSSTTENSGSQRINGITSEGSQHQEN
TSGSKSGTSDSTSVTSSSSVLGSGLVAPVSPYKPGHTVFPLQSAGISYPGSLAGAYAGYP
QHFLPPGMTLDPTKSSSQLLSAQFAAASSLGCSKAGSSPLAGASPPSLMSASLCRDPYCL
SYHCTSHLSGASSGNCAHDSAAAAAAASALKSGYPLMYPTHPLHSMHSSTPSFTGHPLYP
YGFMLPNDPHPHVCNWVSANGPCDKRFSSSEELLSHLRTHTAFAGTDKLISGYPGSASLA
NAAAAMACHMHIPPNGSPGSALALRGPHHPLGLSGRYHPYSKSPLPTPGAPVPVPAATGP
YYSPYAFYGQRLTTASALGYQ
Download sequence
Identical sequences H2LXL0
ENSORLP00000010871 8090.ENSORLP00000010871 XP_004080448.1.28442 ENSORLP00000010871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]