SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010885 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010885
Domain Number 1 Region: 11-127
Classification Level Classification E-value
Superfamily ISP domain 4.19e-22
Family NirD-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010885   Gene: ENSORLG00000008675   Transcript: ENSORLT00000010886
Sequence length 165
Comment pep:known chromosome:MEDAKA1:5:16301820:16303643:-1 gene:ENSORLG00000008675 transcript:ENSORLT00000010886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKDQTAPGLHFVGKKDDLIQAKRSFRTLDGRDVLIIHHEGVFHAIDSYCHHAGGMLQN
GDIEEINGKMCIICPKHKYKITLAEGECLYKGKDPRENPSVTRWFSKGVKQRIHVVTESD
GNVFVKLSVSPGWIESDYYQGEKGKVERAKAEAAERKNPIKEDDD
Download sequence
Identical sequences H2LXM4
8090.ENSORLP00000010885 XP_004068916.1.28442 XP_011473426.1.28442 ENSORLP00000010885 ENSORLP00000010885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]