SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010944 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010944
Domain Number 1 Region: 8-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.71e-88
Family Eukaryotic proteases 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010944   Gene: ENSORLG00000008718   Transcript: ENSORLT00000010945
Sequence length 260
Comment pep:novel chromosome:MEDAKA1:20:15574342:15576486:1 gene:ENSORLG00000008718 transcript:ENSORLT00000010945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSHFHFLFDLQGCGTRPKKRAKIVGGSDALAGSWPWQVSLQMERYGHVCGATLVSNRWLI
SAAHCLYSDPHAWRAYMGMRVMARGNHGAATRLIRRILLHPQYDQFTSDYDIALLELSAP
VFFSDLVQPVCVPASSHTFTTGTSCYVTGWGVLMEDVNAGELASRLQEASVKIINRKTCN
KLYDDAVTPRMMCAGNLQGGVDACQGDSGGPLVCLERGKRWFLAGIVSWGEGCARQNRPG
VYTQVVKFTDWIRLQTKGQV
Download sequence
Identical sequences H2LXT2
8090.ENSORLP00000010944 ENSORLP00000010944 ENSORLP00000010944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]