SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010984 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010984
Domain Number 1 Region: 456-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000447
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010984
Domain Number - Region: 34-139
Classification Level Classification E-value
Superfamily SET domain 0.00379
Family Viral histone H3 Lysine 27 Methyltransferase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010984   Gene: ENSORLG00000008745   Transcript: ENSORLT00000010985
Sequence length 519
Comment pep:known chromosome:MEDAKA1:15:22866661:22869145:1 gene:ENSORLG00000008745 transcript:ENSORLT00000010985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLTMDHALLARSAWTSDCKFVQHPSDLYASVVVTRSIPAGACFGPCLLQNTFYDTIA
FIAQKSSDRRAKSYVFRIDPEAMCNSALVLSWLRLVQAARNEEEKNTEAFLKAGQLYVRT
TREIRPEEELLVWYDQELTHLLGFTDMAKDPQQGQSHTEFKCERCNETFKNEYPFLAHCR
FQCNQRKDDSCVRLVYEHKQLETKKQHRVTDFHNIARDLEHKQSGGIVEAEISPKKRKCD
VTLHPKWRKTVLSEKTNIANYDNILQLVKDCDLTTGAVSSSEDKLKGEMVKVDRKSGDLA
EVVDANGIYTHDVEVGEKREKREGFGVRSSSTSAFSLVLSNNHGEQKSAFCKPSKRTSLL
ETPAYLSGAPTAHPSRIGDMTDGFPSRNVLGYNSLMASSILSSDVQTAASPVGISTAFHY
APEQWCRNIGAQLHTASTLTILPPTFTSFGVSAQNWCAKCNLSFRMTSDLVFHMRSHHKK
EFAVESQVRRRREEKLTCPICHEYFRERHHLSRHMTSHN
Download sequence
Identical sequences H2LXX2
8090.ENSORLP00000010984 ENSORLP00000010984 ENSORLP00000010984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]