SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011010 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011010
Domain Number 1 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 142-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 58-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 354-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000119
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 26-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000123
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 189-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000127
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 273-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000167
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 105-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000585
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011010   Gene: ENSORLG00000008767   Transcript: ENSORLT00000011011
Sequence length 407
Comment pep:novel chromosome:MEDAKA1:8:11956496:11957780:1 gene:ENSORLG00000008767 transcript:ENSORLT00000011011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSTTDEETESTSTTDEEKDPQNRAKKCGNKFSGWPQLKFHMKTHTGEKTFTCKECDKSFR
DVSNLRKHMRIHTGEKTFSCEQCKKCFSKKSNLKTHMRIHTGDKPFTCKECKRSFYQISH
LKSHMRTHTGDKPFTCKECKRSFYQISHLKTHMRTHTGEKPFTCKECDKSFSHKCSLKTH
MRTHTGEKPFSCKECDKCFSEKSTLKKHMRTHTGEKPFTCKECDTSFSRIDHLKTHMRTH
TGEKPFSCKECDKDFSEKSTLKKHMRTHTGEKPFTCKECDKYFSEKSTLKKHMRTHTGDK
PFTCKECKRSFYQISHLKSHMRTHTGEKPFTCKECDKGFSDKSKLKIHMRTHTGEKPFTC
KECDTSFRHRTTLKKHRTHTGEKPFPCNKCDASFSRIPLLKTHMKTH
Download sequence
Identical sequences H2LXZ8
ENSORLP00000011010 ENSORLP00000011010 8090.ENSORLP00000011010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]