SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011031 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011031
Domain Number 1 Region: 24-79
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000286
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 2 Region: 87-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000206
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011031   Gene: ENSORLG00000008785   Transcript: ENSORLT00000011032
Sequence length 168
Comment pep:novel chromosome:MEDAKA1:24:342758:343925:-1 gene:ENSORLG00000008785 transcript:ENSORLT00000011032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANNELPKDWPKRKFQSDLVPDDQKLKYARPGLPAFSQDVLRKWKNEVKLQRKVQCPNQGC
SCVYSSVSGLKAHLGLCTKGEFEAGKYRCLICNKEFNSESGVKYHINSVHSQDWFVTNKK
AFKKFESFLKNRPKEMRPSAQKLVQYPQHPPQHLLQQQQPPPHHLQHF
Download sequence
Identical sequences H2LY19
ENSORLP00000011031 ENSORLP00000011031 8090.ENSORLP00000011031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]