SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011033 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011033
Domain Number 1 Region: 22-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000327
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 224-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000471
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 140-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000136
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 196-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000014
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011033
Domain Number - Region: 116-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00127
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 156-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00149
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011033   Gene: ENSORLG00000008788   Transcript: ENSORLT00000011034
Sequence length 266
Comment pep:known chromosome:MEDAKA1:20:15694341:15697147:-1 gene:ENSORLG00000008788 transcript:ENSORLT00000011034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKLQSQKTYSCSFSDCKSTFGESWKLEAHMCKHTGLKPFSCGNCDERFCTQHQLTRHE
LSHSDEKPIMKNHVSNTQELQKKHFNCHMRVWKEFHKRNQRKLHVSINLCYPFRDCRFPG
CAKEFLSNGKRRHHERVHQGYSCNNEVCPFQAKTWTELQKHKKEHEVKVQCGACQKLFSN
KWFLHLHELRVHSGEKKLLSCPREGCDRKFMRRFNLESHVLGEHEGKKPFICAHAGCGKS
FAMKESLRRHGAVHDPAKKKLKVKLR
Download sequence
Identical sequences H2LY21
8090.ENSORLP00000011033 ENSORLP00000011033 ENSORLP00000011033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]