SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011074 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011074
Domain Number 1 Region: 18-175
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.14e-55
Family TRADD, N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 203-298
Classification Level Classification E-value
Superfamily DEATH domain 2.04e-16
Family DEATH domain, DD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011074   Gene: ENSORLG00000008824   Transcript: ENSORLT00000011075
Sequence length 300
Comment pep:known chromosome:MEDAKA1:3:20439460:20445358:1 gene:ENSORLG00000008824 transcript:ENSORLT00000011075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDPVDVKKMADTTVDGGAWTGCGVLFLQSLCPDVDLLSLYKNQNGKFIVFKVIKLTLTGS
DSAGGLGGYEILKVHDAEPFLGVEVKFVNMAACKQFLDSYSSGALHQSFSQHAGRLFAVA
QECSVETQLKASTNILDHCLDKLEVCLQHIHQSQPERLRDEEIDQLEQQLQTQALGSAPQ
QTPLTQEESSVPSNCFKFQNKIIEDRMLTAVDIQSFSNGVGRQWRHVGRALGKTCRALKA
PAIDNLAYEYEREGLYEQAYQLLTRFVQAEGRAAKLSRLVRALEDCKLTSLAENLLEIQP
Download sequence
Identical sequences H2LY60
ENSORLP00000011074 8090.ENSORLP00000011074 ENSORLP00000011074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]