SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011113 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011113
Domain Number 1 Region: 344-395
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000193
Family PHD domain 0.0048
Further Details:      
 
Domain Number 2 Region: 193-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000145
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011113
Domain Number - Region: 276-337
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00576
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011113   Gene: ENSORLG00000008855   Transcript: ENSORLT00000011114
Sequence length 403
Comment pep:novel chromosome:MEDAKA1:13:17706860:17729935:1 gene:ENSORLG00000008855 transcript:ENSORLT00000011114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPSFSSSLSLGEEFYKEAIEHCRSYNARLCAERSMRLPFLDSQTGVAQSNCYIWMEKNH
RGPPSCHAPGQLYTYPARCWRKKRRLNILEDPRLVPIEFKIDYEASLKKEGGIPDGPVLE
SLLAGETLDKKVETKEEEPMSECQKLLVGDFPHELEVDEMEEDVPKRKNRTKGRAYGVGG
MRKRQEPPAIEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLADEEGEEDSERHTLPFQRK
NNHKHRRWIQVQILVPLHPQKHTETKKAPDGSVIANGYCDFCLGGSKKTGCPEDLISCAD
CGRSAGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDICRLGHLSSEDQLLFCD
DCDRGYHMYCLSPPMSEPPEGSWSCHLCLRQLKEKASAYITLT
Download sequence
Identical sequences H2LY98
8090.ENSORLP00000011113 ENSORLP00000011113 ENSORLP00000011113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]