SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011141 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011141
Domain Number 1 Region: 953-1005
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 410-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000014
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 659-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011141
Domain Number - Region: 696-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000207
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011141   Gene: ENSORLG00000008882   Transcript: ENSORLT00000011142
Sequence length 1117
Comment pep:novel chromosome:MEDAKA1:11:18631160:18637666:-1 gene:ENSORLG00000008882 transcript:ENSORLT00000011142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQANPQPLRSDEDSPGSGVRRAHVLRNQGADSITSGGAADGSDHETHFCPTCCSHF
TTWTDLSQHQNFCKDHPHIFLLKDSAVPVETPLRPSPVPSVATSDSSVVESTGFELGETM
LNENDSLDNSEAGKEWEEVMELDPCPQDSYTSSSSPLPPESAPSPQSSSDYSMPGTNVTL
EILQSTRVAVAQFSQGFGSSGLGGKPASAPLPLILQQLLALQQQQVQQLQLIQHICSQVA
VMNRQPTQAALSPASRSLPVAPSPFPSLAIIPPPILPLSGTMPSSINGQAAVSLSQVLPP
QTLCEQSSFTESGTSESSAPSVLPQPASPSRSSSQTPASCSPPSLTQSGLPSSSSNLPFL
PQSPRSATFPNPLSCMAATASALDPLASLMKLRKGKLLVDAKPEEPFFKHKCRFCAKVFG
SDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKDKYPHVQMNPFPVPEYLDN
VPTSSGIPYGMSIPPEKPASSWLDSKPVVAPLPAGLGLSLSSPAASTGGSSDFVSATPPV
KSPYKAAPGECVTVCPNHRGTEAPFSPVSESQRETGASQTLKAEELHLPHMCSSTAGASP
FTETTRTLATPEPIPSASSASCSPPTTFPAVDPPDCMQTSETSKLQQLVENIDKKIAEPN
QCTLCQCVLSCQSALRMHYRTHTGERPFRCRVCGRAFTTRGNLKTHVDVHRESTPAQVQH
SCPICQQKFTNAVVLQQHIRVHVVGHIPDPTTGDGSHEGGGLSCSKLTDDNLMENDDEKE
ERIDEDMKLTGGLKDNSLMNTAAAYSEEKVENSSEISPHLPDPSPPGSASSFQSDSQGFM
VAEDELDPQELSVKTERPESPAYVSAAARGPRGDPSVREGAPYCVAFQLTQDKGEGQSPA
GFTSRSLTTELNGMMGRQQPPFSIHITAAYPAASGPPPATSVLASVPPRRSGKQHNCSVC
GKNFSSASALQIHERTHTGEKPFVCSVCARAFTTKGNLKVHMGTHMWNNAPARRGRRLSV
ENPVALLGGDPLKFRELFQKDLAPGPVSMERGLWSRYAAAITNSLANNEISVIQTGGVTQ
LLPLTGSGTGLTRTTTDLGGSRHFSMLVDDTKQIGIN
Download sequence
Identical sequences H2LYC6
ENSORLP00000011141 8090.ENSORLP00000011141 ENSORLP00000011141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]