SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011158 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011158
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily POZ domain 2.09e-26
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000002
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011158
Domain Number - Region: 441-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00255
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011158   Gene: ENSORLG00000008895   Transcript: ENSORLT00000011159
Sequence length 524
Comment pep:novel chromosome:MEDAKA1:11:18674221:18678300:-1 gene:ENSORLG00000008895 transcript:ENSORLT00000011159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STVQVCFPGARAAVLDNLNRQREEGQLCDLSIQVQGQVFRAHRCVLAASSPYFHDQALLK
NVTTVSLPSVLDPVAFESVLTSAYTGQLSIVHDDIVHYVTVASFLQMWHIVDKCTEMLKG
PRPSGDGGSAAQPASRQQSPSSTESLYVEREGRRRDRRPDALPPLATWRRPQQLARWARP
RASSAQHMADSQLDGPPGYAESVFSSCEEALASNHTVGPNTNSRLSGGGAVEASKLKGRC
HPRGGQLTTERLPEKEGEESQNGRKSERTETEADEGVGEDGEARSFITNINNTKKFIKGR
PLYKLDSCIGIICRGQEEVGHTTGRHRDHLRTNPPSDHGGVHCSGAGEEATGPEAPVSAR
LQWQMETWSEQDPRQEGGSRSCCKDENDEEEDFEGLTSGGNSRDAYNDITHRALLPVSPD
FSSKATWPSGGEGQSGSVTPTSRKVHFCHCGKAYTLKSMRDRHVKMQHLNLRPFGCPVCS
KSFKMKHHLTKHLKTHGGVQPYECTLCGKKVVWRDSFLRHQARC
Download sequence
Identical sequences H2LYE3
ENSORLP00000011158 8090.ENSORLP00000011158 ENSORLP00000011158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]