SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011293 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011293
Domain Number 1 Region: 501-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-17
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 79-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000115
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 1-45
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000162
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 211-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000397
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 328-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000059
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 150-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000265
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 9 Region: 264-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000319
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011293
Domain Number - Region: 36-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000255
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011293   Gene: ENSORLG00000009007   Transcript: ENSORLT00000011294
Sequence length 554
Comment pep:novel chromosome:MEDAKA1:1:25818535:25820472:1 gene:ENSORLG00000009007 transcript:ENSORLT00000011294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTHTKEKPFTCPLCSKTFSQSYHMTRHMRNLHGAAQHICATCGESLESCTELQKHKKTH
RPKVLLCLDCNEKFTNGSNKLARHMRTHTKEKPFACPVCEMTFSQSYHMTRHVRNQHGLG
QHICSKCGKSFDTWLDLKVHKKTHAIRGLTCFACDKQFKGEAALANHLKLHRKVESSPRS
LVCSDCGKEFGRMYHLKRHLMTHRKGATAECYTCPDCQKVFVFPEDLNKHLENHVKENKG
MCPKCNESFTSAEELEAHMSVHQKSYSCSICGKKFKVEYALKKHEQGHQTEQYFCSLCQK
HFLKLSHYKRHVLVHNRRESKCPHCASVFLQLTAFKYHLRTHTEERPYQCSCCIESFQQK
EDLEQHCLKHRKFKKQKPYSCTRCDSAFSTLVELTEHMSLHEGEPPQTCPVCGKSFLNKN
KLEKHLSIHTGERPHLCSICGNGFPSAASLKLHAHIHTGEKPFQCKQCSKKFSSNSGLRL
HSRQHMDQRPSYECPECGRTYGRMTELKMHQRYHTGDKPYACTCCSKRFISKDKLMVHMR
THTGERPYSCPHCG
Download sequence
Identical sequences H2LYS3
8090.ENSORLP00000011293 ENSORLP00000011293 ENSORLP00000011293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]