SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011459 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011459
Domain Number 1 Region: 565-1023
Classification Level Classification E-value
Superfamily Ras GEF 5.23e-132
Family Ras GEF 0.000000000000848
Further Details:      
 
Domain Number 2 Region: 6-176
Classification Level Classification E-value
Superfamily Histone-fold 7.59e-55
Family TBP-associated factors, TAFs 0.000000467
Further Details:      
 
Domain Number 3 Region: 208-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-41
Family DBL homology domain (DH-domain) 0.000000232
Further Details:      
 
Domain Number 4 Region: 416-571
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-35
Family Pleckstrin-homology domain (PH domain) 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011459   Gene: ENSORLG00000009137   Transcript: ENSORLT00000011460
Sequence length 1028
Comment pep:novel chromosome:MEDAKA1:22:724675:746779:1 gene:ENSORLG00000009137 transcript:ENSORLT00000011460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQQIYDFSSEENSQKWRGLFVQALRKVQKQVHPNLTAKEDALQHVEELILQLLNMLCV
AQPRTVQDVEERVQKTFPHPIDKWAINDAAAAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVCNIRHFEISQQDIKVSMCADKVLMDMFDQEED
IGLMSQSTEEPSASEEVTYDDLVRLEIAEERQYLRELDLIIKVFRHHFMTNPKIFTPQDV
EVIFSNILDIHELTVKLLGLIEDAVEMTADGCPHPLVGSCFEDLAEEQAFDPYEILSQDI
LSKDFHEHFNNLMARSTVGLYFQSVAEGFKEAVQYVLPQLMMVPVYHCLHYFELLQQLQE
RSKDQDDRECLKQAITALLNLQCSIERSYNKHQPRRKPGEPMYRLYSRQNRSKQLAIKRM
NEIQKSIDGWEGKDIGQCCSEFILEGPLIRAGAKHERHNFLFDGLMISCKANQSSRLPGA
GNGAEYRLKEKFVLRKVRIVDRDDSADLRHAFELMGKDENCAVFCARTAEEKDSWMAALM
TLQYRSTLDRMLDTALHTEEQEHPLRLPSPDVYRFAVQDSEENIVFEDKLQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIDRIEIPEPEPSEEDLQA
LWNGEQPMAAELQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDPDLRSRLEDYITSRI
QLRGKSMRKWVESINKIIRRKLQTQLNGVSHNITFESSPPPIQWHICTAGQVEQFDLMTL
HPIEIARQLTLIESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VETMNLEERAAVLSRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKRK
VLEDAVDLSQDHFKKYLIKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKDLINFS
KRRKVAEITGEIQQYQNQPYCLRMEQDIRRFFENLNPMGSKSEKEFSDYLFKMSLEIEPR
NCKQPPRF
Download sequence
Identical sequences H2LZ87
ENSORLP00000011459 ENSORLP00000011459 8090.ENSORLP00000011459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]