SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011539 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000011539
Domain Number - Region: 148-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000255
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 83-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00527
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011539   Gene: ENSORLG00000009201   Transcript: ENSORLT00000011540
Sequence length 290
Comment pep:known chromosome:MEDAKA1:15:23215913:23218731:-1 gene:ENSORLG00000009201 transcript:ENSORLT00000011540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPEVYPFDNISAASRNSEQDPTEASRQQLSEDGHPFSFSPQIVRLHREHDMFEDGDIH
RHLYLQDLYTSEAEDRTTLSVSEFPCHISGCSAQFSSLGEYEHHYNSLHRNVCSSCRRCL
PSARLLDIHIQEWHDSLFAVLAQKQDMYLCLVEGCGQKFRTGKQRKDHLIRIHKYPPDFR
FDKLKKERGNKGGRGQEQKVKVIEAVNDVCESEGVCEVLCNPMSDQPEEEESMEICEKEA
PLMEDMPSPVQDSEVNALPLNPQYSRRIPKTVCFGHGSSRSFRGQRGRKK
Download sequence
Identical sequences H2LZG7
ENSORLP00000011539 8090.ENSORLP00000011539 XP_004077225.1.28442 ENSORLP00000011539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]