SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011590 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011590
Domain Number 1 Region: 182-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-17
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 156-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000013
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 224-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000811
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011590
Domain Number - Region: 105-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00109
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011590   Gene: ENSORLG00000009246   Transcript: ENSORLT00000011591
Sequence length 266
Comment pep:novel chromosome:MEDAKA1:7:14975438:14976847:-1 gene:ENSORLG00000009246 transcript:ENSORLT00000011591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKYFSSKKPCYRENHLESQRAFVPESFPKAELPTQNHSSALTCNTTTPFCTSF
VTPAPVSPITPPSSMPLAPLDLSSSSSSSSGEEEEDGGRSSDPPSPDAVHHIYQCLHCNK
SYSSLASLSHHQISHQQLVSAQQTPSLSGEASIRPVFHCKHCSKKYTSLGALKMHIRSHT
LPCVCPTCGKAFSRPWLLRGHIRTHTGERPFACQHCNRAFADRSNLRAHLQTHSEVKKYQ
CSSCSRTFSRMSLLHKHCASGSCCAS
Download sequence
Identical sequences H2LZL8
8090.ENSORLP00000011590 ENSORLP00000011590 XP_011475494.1.28442 XP_011475495.1.28442 XP_020560370.1.28442 ENSORLP00000011590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]