SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011624 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011624
Domain Number 1 Region: 73-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000511
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 1680-1728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000461
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011624
Domain Number - Region: 611-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000121
Family Classic zinc finger, C2H2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011624   Gene: ENSORLG00000009270   Transcript: ENSORLT00000011625
Sequence length 2264
Comment pep:novel chromosome:MEDAKA1:11:18969547:18981183:1 gene:ENSORLG00000009270 transcript:ENSORLT00000011625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAVSHTPAPSGPSALPQSQPPVVHTCQSISASVPSTIQVPVTPGSSHVQMTTVMNIGAEQ
TSKDQKPKKPGKYVCEYCQRACAKPSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHK
KSHAHAIKLGMISRSESGGGSLSTESDKAVGAQSEVEESGDSDDEGSAVDLEPESSQSSI
APLSDCSSQNVTPLETDVSIKSSPGRRAHEPKVPTALPKVVVYPVNVSPLRADSPRVAGA
APEQAAAQRQREFQATRPNVTVLSSLKEVDGTSGSLDAVSEDEEQQCKSPLLGSHGQLQR
QQATDYSQQQQPKCLLSPRSLGSTDSGYFSRSESADQAMSPPSPFVKITPPVDAEVAKSV
PLIAPPVVSTVMHVAADQRMRPSEKVIRHPLEPSARSLEERISKLISDNEAVVDNKQLDS
VKPRRTSLSRRGSIDSPRSYIFKDSFQFDLKPMGRRSSSSSDIPKSPFTPTDKSKHVFLL
SVPNQYPPMDCLPITRSNSMPTTPGHSVPPPSINPVPRPLRGCQSFDEKISSLNDEVFLS
APPTPNPAIHSRTLVRQKAVDDFSTSEGHSLVAVRSMDEGYHGHSSLVEQMQRSRSFEHG
QDRSRRPQQNKGTMYECETCRNRYRKLENFETHKKFYCSELHGPKNKPLVVKEPEEDVFH
VNTQQHIPSGTGALDQQTSIRKRRKMKSVGDEDDQSPTDTIPPCLVGCEATTTLPNKNFS
QTGLIVDIQPNSQSKPPQIQLVARGMNTAESRLSPIQEMNISGAAKGDLQRQGSGTSVIR
HTNSLSRPNSFETDSLDRVSPDVLEKDQMKSPQLDRSSGVSTDSYQEKAFKPTCDEYRKL
GREYSSDSMSAASSTPVNQSRLVRQSNILVPEILVTEDSDREHEPNTSEPADKPAEQFNW
PQRSESLSKLPAEKLPPKKKRIRLAQMDQSSGDSSFESSFSRSLSRDSSLSRGSSISASF
DREETIRSESPSRGEGKTPEPQSLPVALNTLGVPGMMRRAASEQITCTQPSVEISCDYRS
KSFDCGNVPPRRCLSPIGQPKTGQVAQVPLIERRRGPLVRQMSLKIGPESQQPVRKSAIG
TLDKALIANVSSLGQYRSQQINIVSRRAPVASAILNTAEPPLQQHEQLVQSINLGSPTQQ
QQVHGLPHPWYQTAKVQFSQKVQQALSKTSVCGENLQDKPSDFEKNKSFVPKYQLQCPSQ
TFSFCTQGTQIALPILTIPIANPILSISKSSDIIQNVFVASQQTSDVKTQTVVFSSKQQK
EPLDHSQTGTASLPQILITHEQMHQSSSQSSKHYQLSTQSAEVPHDRTQTAAVPAPHTAD
HSSLGSLQCMQKLASVTLCPQQEPAASSKRMLSPANSLDIYMEKHQKRAKDEHGVACLTD
GRSAGYLNSKISEVSRQRKLMLVRQVCTTEPVDSPIETEAPPLPDLKPNEEKNSEADDGV
KPMSPDAVGVEKSRAKEINEKKDPVINTTSLPPDNSLKPQEKSEEQRWTPAKSLIRPSSF
HAGQVKLTTSVSAVNTKEAHRLSFPSLKTTTTFTWCFLMKRKPIHMQQTDLKTSAYAAWT
VSTDNSNPLGLPTKVVLSLFDSKHSSRKIHYTSAIRTSRESDILSFSGKLKDVMLKQMPA
SQKSVSSETRCKPQPEPQTSHDSEKDAPLLSEPRRVKIFDGGFKSNEEYVYVRGRGRGKY
ICEECGIRCKKPSMLRKHIRTHSDVRPFHCVHCNFSFKTKGNLTKHMKSKAHRKKCMETG
VPEGVMEDQDAEDSGDRSQLSGADRQDSDGDDSDGPDDDDNDEEEEDDSQAESGLSTNPS
VSASPQHLPYRDAEFPPSALLAQMSISSVPASQPAAPEPPASDFASTAFFHPQTSVSCRG
SAHLPASPPPAVTSDSYTSDPESVHMMSPISPCRQMSIDYPDFDGPFSPPAQGKVYKLGQ
VSSFAPPPLTLLMQDPHAPPSTASADSNTPVDRSTQTSYPAQVPPPLPPHTQMQAVRAQT
HLFSHLPLHSQQPAPLPYSMLPVGGIQLLPAGLATFLPIQAGPVQLTIPAVSVIHRNTSP
LPPPNTPPHPESLQTHPVVVQEPLSSVVPCFPLGQVAGLQAQTLNLMGLTNPGLASTPLL
PPQGLTLNAALGLQVLAANPNSQSSAGPQAHVPGLQIVNIALPAIIPSLSPLSALSPRPG
SLDMQSSPEASSAPPAGPAWGSVPPNPGGCSPSMKQTVEWNEKEKPPPQRPASAPQIPAE
HPKSAPDPQAVELAVPVFENSRQTTIDDYNEASSDDEDRLVIAT
Download sequence
Identical sequences H2LZQ1
ENSORLP00000011624 8090.ENSORLP00000011624 ENSORLP00000011624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]