SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011682 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011682
Domain Number 1 Region: 338-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000507
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011682
Domain Number - Region: 616-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000138
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 574-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.025
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011682   Gene: ENSORLG00000009317   Transcript: ENSORLT00000011683
Sequence length 689
Comment pep:novel chromosome:MEDAKA1:6:14384766:14388784:1 gene:ENSORLG00000009317 transcript:ENSORLT00000011683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKGIEGSKAGEGEKQKDGGNLSQESGACLKDGRQEDFGEGYFLGQIEEDKEVRDSAEEA
SVTGGLQETLNCRGGEEKEEEEAISNQSQTKSKCSLLPQQSQHSSSSSTAKASGTLDSKT
AASPKSSHTPPSPKSFPFSPISPKYFSCPSSSSAILNETEVKDIKGDEGWISGFPQSFRS
QQSSLVFPLAGMEPASKPAEDDMLPGVPHSSVSNGNGAKAPEPNDSQLDTEVDDKKDKED
QKDAVLKNLSQDFSNSVTSHMTMMHSRNSCKTLKCPKCNWHYKSLHTLQVHMKEKHPETG
GQCVCGASGGKCVCGGVTRDVCGYCSSGKPHPRLARGETYACGYKPYRCEVCDYATSSKG
NLSIHMQSDKHLNNVQNGGSTNGPVNTSHTANNSSSSSNNSSVDEQPYNKLPPSIPTHMT
QPVKLTPPAHSHSHGKRWRCDVCDYELCLFSGPELSLNMRLTSQQVTDPPVTLGSTLSVF
QCLICSCFSSDSLESVEQHLNAPRSLPQSEWCSLIAGGCHCRLCGYTTPLRANFSLHCQT
DRHRTRYQLAAHLQEGGDRGQEGAALIAKGNPVQLRCNLCDYVSSSLEKLRLHSLSSHHE
ASVRVYRSKFLQQYDGEVDGGSWLFHCLLCNHSSSSKLQVLKHSQTSAHQQREGLLQLQP
MGGEELAAIFTIRKSSSGVTDCPVPFMPS
Download sequence
Identical sequences H2LZV9
ENSORLP00000011682 ENSORLP00000011682 8090.ENSORLP00000011682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]