SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011755 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011755
Domain Number 1 Region: 271-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 210-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-17
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011755   Gene: ENSORLG00000009376   Transcript: ENSORLT00000011756
Sequence length 383
Comment pep:novel chromosome:MEDAKA1:24:1180352:1187107:1 gene:ENSORLG00000009376 transcript:ENSORLT00000011756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDELDSKPELLVQFVQNASIRLVQSLEESESKHPCLPPLAPDGGLGHESGTPVSLSGF
GCQSEPSALVVHSQPRTSPSPPAILHDLQQPDSSSYVLLNLAKGITASEESLLFTTDGGE
EDEDEGVSPGDYGVDGNAPWYLRVQELAHDSLIAATRAQLAKDARASQGYLGDHTHSLLA
DGDKQEAPSRTSLPLGKQILRCSFEGCCRTFTWPAHLKYHLKTHRNDRMFRCSAEGCGKS
FYVLQRLQVHMRTHNGEKPFICKEKNCGKKFTTAGNLKNHRRIHTGEKPFLCETDGCGRS
FAEYSSLRKHMLVHSGEKPHLCGICGKTFSQSGSRNVHMRKRHGEEGLGDGGGRETGSCL
TQSVSDTCRGAAGWSSGDPGFSI
Download sequence
Identical sequences H2M032
ENSORLP00000011755 ENSORLP00000011755 8090.ENSORLP00000011755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]