SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011768 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011768
Domain Number 1 Region: 12-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-77
Family Eukaryotic proteases 0.00000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011768   Gene: ENSORLG00000009387   Transcript: ENSORLT00000011769
Sequence length 269
Comment pep:novel chromosome:MEDAKA1:15:23257143:23258458:1 gene:ENSORLG00000009387 transcript:ENSORLT00000011769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLIRFCISLNAIKFTCGERHEGRKNKVVGGSFTTVESQPWISAIFKKKRFLCGGSLISP
CWVLTATHCFSDEIDAKAEDLTVFLGKSAINDTDSEREQKFTVEKMIIHPKYNNFNNDIA
LLKIRGAEGGCAVKTPSVRTVCLPPLHTQLPPGFKCSIAGFGKESSESWQYSQILKQADV
NLMSSTECKREPNYQRMLTENMLCAAGPDWSTDSCQGDSGGPLVCEASGRMFLFGVVSWG
DGCASKDMPGVYTKLTNYNKWIAEETALS
Download sequence
Identical sequences H2M045
ENSORLP00000011768 8090.ENSORLP00000011768 ENSORLP00000011768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]