SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011769 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011769
Domain Number 1 Region: 183-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-49
Family DBL homology domain (DH-domain) 0.000000208
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.17e-36
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 379-542
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-30
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 636-757
Classification Level Classification E-value
Superfamily SH2 domain 1.8e-25
Family SH2 domain 0.00078
Further Details:      
 
Domain Number 5 Region: 766-826
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-19
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011769   Gene: ENSORLG00000009385   Transcript: ENSORLT00000011770
Sequence length 832
Comment pep:novel chromosome:MEDAKA1:1:26424478:26451137:-1 gene:ENSORLG00000009385 transcript:ENSORLT00000011770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAMWLIECRVLPENHRVTVGHAQVCDLAQALRDGVLLCQLLNNLLPQAVNLKEI
NLRPQMSQFLCLKNIRTFLGVCQEKFHLKKNELFEAFELFDVRDFGKVINTLSILSHSPI
ALKRGLQPFPFEGCASDDEIYSGLSDQIDDTVDEDDDLYDFVEDEDNEGDDIYEDLMKRD
EQSENQQNTGVDKRACCLNEILQTEEKYTETLESILQNFMKPLERFLQVEDIESIFINIK
ELAVTHRRLLEEVRVSINDRGAINLYQVFVKYKEKLLLYGNYCSQVEAATKNLDRLSNTR
EEIRMKLEECSNRANRGRFSLRDLLMVPIQRVLKYHLLLQELIKHTNEPSEKENLREALD
AMKDLAQCVNEVKRDNEIIKQITTFQMSIENLTQSLALYGRPKIDGELKISSSEKKSKQD
RYAFLFDKAVVICKKKSGETFELKEMLELNHYQIRDEVAGEKDNKKWSHAFLLLDCYGKC
GYDFYFKTRELKKKWLEQFQMAISNMIPENFSANNHDFQMHCFEDTTSCKACLMLLRGTF
FQGYQCSRCKMPAHKECLGRVSACGRNSDLSFEIIGTSRIIKVSLHLSSKLKYFYGFPKM
EVSQEYYSLPPPPVGFGQPLHLSKGDLIELTRADADQSWWEGKNLTTGQMGWFPCQKVHP
YISKPPPNLSTYNWFAGNMDRTAAKNLLMSRSDGTFLVRQKDGGEFAISVKFNMDIRHIK
ITTTDGLYRINEKKAFKCLTEMIQFYQQNSLKEYFRDVDTTLRXXXXMKYFGVARARYDF
SARDRLELSLREGDTIKILSKKGHSGWWKGEVFGRVGLFPSNYVDEDYSDYC
Download sequence
Identical sequences H2M046
8090.ENSORLP00000011769 ENSORLP00000011769 ENSORLP00000011769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]