SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011842 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011842
Domain Number 1 Region: 277-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-20
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 2 Region: 239-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000226
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 3 Region: 321-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000509
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011842   Gene: ENSORLG00000009449   Transcript: ENSORLT00000011843
Sequence length 358
Comment pep:novel chromosome:MEDAKA1:24:1229906:1234562:-1 gene:ENSORLG00000009449 transcript:ENSORLT00000011843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNMASGDTLYIETDGSEMPAEIVELHEIEVETIPVETIETTVVGGQPMIALQPLVTDDHS
SEVILVQTREEVVGGDDSDLHTDGGDGFEDQILIPVPAPGVEDEYIEQTLVAVAGKSSVG
RMKRGGGAGGKKTGKKSYLSGADGGGRKWEQKQVQIKTLEGEFSVTMWASGDNKDIDHES
VVEEQIVGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTI
ACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCT
FEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
Download sequence
Identical sequences H2M0B8
ENSORLP00000011842 ENSORLP00000011842 8090.ENSORLP00000011842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]