SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011920 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011920
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000176
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 46-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000113
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011920
Domain Number - Region: 116-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000864
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011920   Gene: ENSORLG00000009508   Transcript: ENSORLT00000011921
Sequence length 533
Comment pep:novel chromosome:MEDAKA1:5:17367655:17373003:-1 gene:ENSORLG00000009508 transcript:ENSORLT00000011921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTYDKACRLKIHMRSHTGERPFLCDSEGCGWSFTSMSKLLRHKRKHDDDRRFVCTEEGCG
KSFTRAEHLKGHSITHLGTKPFQCHTEGCNAKFSARSSLYIHSKKHKQDASSLKTRCPVA
NCSKFFSARSSLKSHMLKHHQLRPDVFSHMETTPSLTPSSELVSSNLTPVAAPGAAGGDQ
LPSLDLSSLLSAVPGDPAPTAGIMDLSLVSSGILTIDPSSVGTTLVASSNTTMAKALDPL
IMAPNADIVPHHGLEGTGDVLPPQGTLNLDDVQTVTPEALGSLTMHGSGVSVDPSMQHPL
GSSSSLSVEPSSLAVAPVAELLASPPKVVEVGGQEGSGPLLGCVEVLGPQEGGKVLTHFV
FPSQSSSFSQQRDLELSAVSPSSFLESGGSARTDYRAIQLAKKKKQRGSCATSGASGACQ
RKAKGSKVSSAPAPLTSSSGRCGDGAVTVSGGLTLRDPVTGAQYVQIQLLQDDPAADGDL
AFQLSSQPSSSHSQLTVDLPVNILQEPSGMTEDHGGSDSSQFTGSTINLQDLE
Download sequence
Identical sequences H2M0J6
ENSORLP00000011920 8090.ENSORLP00000011920 ENSORLP00000011920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]