SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011974 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000011974
Domain Number - Region: 82-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00289
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011974   Gene: ENSORLG00000009553   Transcript: ENSORLT00000011975
Sequence length 742
Comment pep:novel chromosome:MEDAKA1:3:21247448:21252388:-1 gene:ENSORLG00000009553 transcript:ENSORLT00000011975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLCREIIKPTISELTKEVRKNILCTVEGCGKILPNTPALNMHLVKSHRIKDGIINPTVR
KDMKASQKVYCCPVEGCPRGPNRPFSQFSLVKQHYMKMHAEKKHKCSKCSNGYSTEWDLK
RHIEDCGKTYQCTCGCPYASRAALLSHIYRTGHEIPSEHRVPPVKKRKMEKLLSGSEKVK
TNDFPNSIVPAMKEHAETTLPTDSTAHTPDPLNQSSTANRSLQKFLLPKPRMTLVSFPVM
QLAHLPVLVPSTESGPLRSVVLAVDSQCSVSTLQLLPHTAEDVNAKSAFKESKTACFSNQ
GPISTGVQVNLKAVNANDLACSMAAQQRGGSSTDIQRDKSILSRMPTEGEEGMEFSGLVE
PSVSSFSQTDISVSAQILLPVSVQTQTFFFPAKAKSSIGAQTDSQTAKLPLQTPSSTMLP
YKTRQTQTHFSIPQLEEKVQDPAVMCSDLLGFDSQSVSTQTTLDLDESLGTSGSTIYQDS
KSVGGMSFGVQTQELSSSNMADNQTQTMTLLNDLENILSGSMTGHHALTEASTVCGSGLS
SVQEQHTGIEFDFEEFLNAVHIHTQTEESELGGLSGDSPLESLDIQTQTDFFLMNELDQS
DGSTRPQASDLELFDTQTQTDLNFLLNSGSNLPLSTLLRHSSFSISTESSDTETQTDLPA
FATGTHLQTHVGQGEHVRLLNSTETQTVTRQAEGLGHLFLTSNETQTVMDDFLSADMAWN
MDSHLSSVETQTCEELCALFQH
Download sequence
Identical sequences H2M0P8
8090.ENSORLP00000011974 ENSORLP00000011974 ENSORLP00000011974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]