SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012061 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012061
Domain Number 1 Region: 151-244,279-607
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-36
Family Hermes transposase-like 0.0081
Further Details:      
 
Domain Number 2 Region: 90-127
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.0000418
Family Hermes dimerisation domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012061
Domain Number - Region: 5-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0202
Family BED zinc finger 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012061   Gene: ENSORLG00000009621   Transcript: ENSORLT00000012062
Sequence length 614
Comment pep:novel chromosome:MEDAKA1:8:13238831:13240948:-1 gene:ENSORLG00000009621 transcript:ENSORLT00000012062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRYRHHFTYKADQGKNIIVQCNLCLPRVNLLSTSKTSTSNLKKHLDRTHLGCEARPDAKR
GRKKEEYNGEESRHCQLKKLKAEIISKCITQSKIDEFIFNFIVEDCHSFYVLEQPGFRKL
IAGLTEGLKVMDRVTLFTKVDQSFSRMREELMSKLSSIQYVCTTADIWTANNRSFFGMTC
HWIDTESLERKSAALGFVRLQGRITYDAIAGRIHDIHVTYNLESKVQTTVTDNGSPFVSV
FREFAVDTTETDDDIGFYENVSAVLEGEPEQDMLLFLPSVQRCASHTLEQIVNEDFWQAV
SQGPMCQLFYSAMAKVFAMWNKCHHLQVGLDAAEEIGKMALAVPAVIRWNVEYCAVQKIV
SLSERELTELCARLEVPRLLAEELSFLKEYVTVFHPLAFALELFQAEQKCYLGLVIPTVL
SLKNKLNEQKDAANYFSDVIKSIVVAIEVRFQELFTSTEAKIATATTPQFRLWWMAASER
EEMCSLLATEASQMDPCSTTEANTSRSLSTIKSEDDFFSYGSAKTTVKIQQWGVTEEVRK
YVEGTGKSLECLQDFPRVKQLFLKYNTTLPSTAPVQRLFSQKGNLVTSQRNSLTDDYFER
IQLLRYNSSVCSLV
Download sequence
Identical sequences H2M0Y3
ENSORLP00000012061 8090.ENSORLP00000012061 ENSORLP00000012061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]