SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012074 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012074
Domain Number 1 Region: 334-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000744
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 563-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000247
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 30-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000625
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 470-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000027
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 380-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000308
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 423-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000477
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 7 Region: 626-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000994
Family Classic zinc finger, C2H2 0.05
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012074
Domain Number - Region: 96-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00411
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012074   Gene: ENSORLG00000009630   Transcript: ENSORLT00000012075
Sequence length 698
Comment pep:novel chromosome:MEDAKA1:7:15952041:15959548:1 gene:ENSORLG00000009630 transcript:ENSORLT00000012075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLDFDDSADGKRKGRPKPEVQELRSIPVSAHLIVQWKEEFKRHSRVKCPRSGCWLEFPS
IYGVKYHYQRCQGVRKSCSGGSLHFTAIPVKKKAIPATVTEKLSHSCPYCDAAFATKVRL
QKHKLWNHPDKVAKDPKEELPKLQKTHFKSNIKKRSQTCCECNTKLYFLCVFRPMENSPP
SPVFFKVKKTHEMSTPSYNGELAHQRSERKQHSHSQPSQQSEQVQSPHSQSQSQSTLSDA
GGSESEGGSLPPSLPDEDPERMKHRRKQKTPKKFTGEQPSISGTFGLKGMAKVEEKLKAG
RMKRQEGSGFSEEPQRRPSSSQSSKKEPALSSSGAVHDTQWQRTISERGEVVCPTCSIVT
RKTIHGLKKHMEICQKLQDALKCQQCHKQFRSKAGLNYHTMAEHNTKPSGSEDQTSNENE
ERERLRRVLKQMGRIKCPSEGCSAHFSSLMGYQYHQQRCGREFSDEEQLAFLCQHCGKNY
RSKAGRDYHVRTEHSPSITTSKEKAAQTLIQEEDFERTPSGRVRRRSAQVAVFHLQEIAE
DELAKDWGTKRRIKDDLVPDSKRLNYTRPGLPSFSPELLESWKNQVKEKGFICCSNANCE
AVYSSVSGLKAHLANCSQGAGEMGKYTCLICQKEFSSESGVKYHISKTHSQNWFRTAANH
VVSGNKSKVEENNGIRAEVRNGATTGKKRGRKPKERPS
Download sequence
Identical sequences H2M0Z3
ENSORLP00000012074 8090.ENSORLP00000012072 ENSORLP00000012072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]