SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012149 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012149
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily POZ domain 4.51e-29
Family BTB/POZ domain 0.00061
Further Details:      
 
Domain Number 2 Region: 454-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012149   Gene: ENSORLG00000009686   Transcript: ENSORLT00000012150
Sequence length 636
Comment pep:novel chromosome:MEDAKA1:7:16034776:16076235:1 gene:ENSORLG00000009686 transcript:ENSORLT00000012150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEISSHYRQLLRELNEQRQHGILCDACVIVDGKIFKAHKNVLLGSSRYFKTLY
CQVKKGAEPHHQTTVTHLDIVTATGFKAILDFMYSAHLALTSKNVIEVMSAASYLQMTDI
VQACHSFIKAALDISIRSEMADELADFEMGAVAAGLGGGGGALASIMSGRSTSPWLARRT
SPANSSGDSAIASCHEGGSTYGKEDQEPPKSHESQEEACHDSQPAWPHDYRPINVKEEQV
SPASSSHPRDTPKGAAPSQSEQGAGGAGGGVGDGSWQQLSGSGRRKNRKNKDTVRHITQQ
AERNWDRERERYRDSRPGSPLPSMLAVAGWNYNGQDIPGADVTEPNSSDSRGERLDFFVK
QEEALTAEPSFLGTNENEEASRGAGAGISSVANLKAALMSKNSLLSLRAEMMGDDNPLLY
EYLPKGGHSLSLNDFTVIRKKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFT
RREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIKHGSRRHGVCADCSGRGMAALLDHN
GEVGGDISPEEELYPGDRFHDDQAECDGDGEGEEEMMVEGDGEILGEGEEEGGKWKDSGM
TTEEHRALDNEKEESDSSVQEGEQQNGSEKDFAWIS
Download sequence
Identical sequences H2M168
8090.ENSORLP00000012149 ENSORLP00000012149 ENSORLP00000012149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]